Monday, 25 February 2008

avril lavigne tabs girlfriend tab



Avril Lavigne Tabs | Girlfriend Tab

Download Mp3

Avril Lavigne Tabs | Girlfriend Tab

Avril Lavigne - Girlfriend / Album: The Best Damn Thing / Year: 2007

Standard E tuning

Intro:

[ riff 1 ]

D5 ... D5 F#5 G5

e|-----|---------------|

B|-----|---------------|

G|--7--|---------------|

D|--7--|--'12--/4--'5--|

A|--5--|--'12--/4--'5--|

E|-----|--'10--/2--'3--|

D5 (stuck once)

Hey Hey - You You!

I don't like your girlfriend

No way No way

I think you need a new one

Hey Hey You You!

I could be your girlfriend [riff 1]

D5 (struck once)

Hey Hey - You You!

I know that you like me

No way No way

No, it's not a secret

Hey Hey You You!

I want to be your girlfriend [riff 1]

Verse1:

D5 A5 B5 G5 (chords used)

e|----------------------|

B|----------------------|

G|--7----2----4---------|

D|--7----2----4----5----|

A|--5----0----2----5----|

E|-----------------3----|

(Guitar 1)

e|---------------------------------------------------|

B|---------------------------------------------------|

G|----7-7---7-7---7-7---7-7---2-2---2-2---2-2---2-2--|

D|----7-7---7-7---7-7---7-7---2-2---2-2---2-2---2-2--|

A|--5-----5-----5-----5-----0-----0-----0-----0------|

E|---------------------------------------------------|

e|---------------------------------------------------|

B|---------------------------------------------------|

G|----4-4---4-4---4-4---4-4--------------------------|

D|----4-4---4-4---4-4---4-4---5-5---5-5---5-5---5-5--|

A|--2-----2-----2-----2-------5-5---5-5---5-5---5-5--|

E|--------------------------3------3-----3-----3-----|

You're so fine

I want you mine

You're so delicious

I think about you all the time

You're so addictive

Don't you know

What I can do

To make you feel alright

(Guitar 2 comes in over rythm like harmonics)

(play first part over D5 A5 B5, second over G5)

e|-----........------|

B|-----........------|

G|--7~-........------|

D|----........-5----|

A|--5~-........-----|

E|-----........-3----|

Don't pretend

I think you know

I'm damn precious

And hell Yeah

I'm the mother fucking princess

I can tell you like me too

And you know I'm right

Prechorus1:

Bm F# A G A5

e|--2----2----5----3-----|

B|--3----2----5----3-----|

G|--4----3----6----4-----|

D|--4----4----7----5--7--|

A|--2----4----7----5--7--|

E|-------2----5----3--5--|

She's like so whatever

You can do so much better

I think we should get together now

Well that's what everyone's talking about

Chorus1:

(3X and then play riff)

D5 A5 B5 G5 D5 F#5 G5

e|--------------| |---------------|

B|--------------| |---------------|

G|--7-----------| |---------------|

D|--7--7-/7-'5--| |--'12--/4--'5--|

A|--5--7-/-'5--| |--'12--/4--'5--|

E|-----5-/9-'3--| |--'10--/2--'3--|

Hey Hey You You

I don't like your girlfriend

No way No way

I think you need a new one

Hey Hey You You

I could be your girlfriend

Hey Hey You You

I know that you like me

No way No way

No, it's not a secret

Hey Hey You You

I want to be your girlfriend

Verse2:

D5 A5 B5 G5 (same as before)

I can see the way

I see the way you look at me

And even when you look away

I know you think of me

I know you talk about me all the time

Again and again

So come over here

and tell me what I wanna hear

Better, yeah, make your girlfriend disappear

I don't wanna hear you say her name

ever again

Prechorus2:

Bm F# A G A5 (same as before)

She's like so whatever

You can do so much better

I think we should get together now

Well that's what everyone's talking about

Chorus2:

(3X and then play riff)

D5 A5 B5 G5 D5 F#5 G5

Hey Hey You You

I don't like your girlfriend

No way No way

I think you need a new one

Hey Hey You You

I could be your girlfriend

Hey Hey You You

I know that you like me

No way No way

No, it's not a secret

Hey Hey You You

I want to be your girlfriend

Bridge:

(clapping and stomping)

In a second you'll be wrapped around my finger

'Cause I can, cause I can do it better

There's no other, so when's it gonna sink in

She's so stupid, what the hell were you thinking?

In a second you'll be wrapped around my finger

'Cause I can, cause I can do it better

There's no other, so when's it gonna sink in

She's so stupid, what the hell were you thinking?

Chorus3:

D5

Hey Hey You You

I don't like your girlfriend

No way No way

I think you need a new one

Hey Hey You You

I could be your girlfriend [riff1]

(until the end)

D5 A5 B5 G5

e|--------------|

B|--------------|

G|--7-----------|

D|--7--7-/7-'5--|

A|--5--7-/-'5--|

E|-----5-/9-'3--|

(No Way)

Hey Hey You You

I know that you like me

No way No way

No, it's not a secret

Hey Hey You You

I want to be your girlfriend

Hey Hey You You

I don't like your girlfriend ( No Way!)

No way No way

I think you need a new one (Hey!)

Hey Hey You You

I could be your girlfriend (No Way!)

...

...

Ends with D5 of course. ;)

Diposting oleh admin :) di 10:04 AM

Label: Avril Lavigne

0 komentar:

Post a Comment

Subscribe to: Post Comments (Atom)

Recent Song Lyrics

Google

Enter your search terms _______________________________ Submit search

form Search

Add This

Be sure to bookmark this site!

Refferal

Subscribe

Enter your email address:

____________________

Subscribe

Delivered by FeedBurner

RSS

Add to Google Reader or Homepage

Search Lyrics by Artist

* 0-9

* A-B

* C-D

* E-F

* G-H

* I-J

* K-L

* M-N

* O-P

* Q-R

* S-T

* U-V

* W-X

* Y-Z

My Link

* All About Medical

* Free Download Game

* Free Download Mp3

* Phone Updated

Blog Archive


word girlfriend



The word "girlfriend"

I can't seem to understand why it is some people have a difficulty

with the words girlfriend and boyfriend. It seems to be something that

society's insecurities has amplified over time. I say this because in

my earlier years, I don't remember it being as it is today. To me this

is sad, because a byproduct of this behaviour is an element of game

playing. Not huge, but a big part of game playing is a lack of

honesty. See the connection? How many of you ever thought at the so

important fork in the road of dating someone......... do they or don't

they?

The first time the word gets used, there is an undeniable bridge which

gets crossed. Really though, the bridge was crossed before the word

was uttered. It's just that hearing it reinforces what already is.

For me, feeling strongly for a woman and being mutually exclusive with

her makes her my girlfriend. In the case of R, this seemed to occour

quite quickly. Criteria: strong feelings? Oh my yes! and Exclusivity?

To me she is the only woman in the word. Of course this all caused me

much joy. :-) I would think it's always a two way street, but perhaps

not. Either way, a typical perspective from me.........a strong and

clear one.

The thing of it is, I can't play games. I can probably count on one

hand the number of times someone was able to complain that they didn't

know what I was truely thinking. I know I know, not great for the

mystery factor, but it's who I am.

I was planning on blogging on a ton of other stuff tonight but it came

up last night, so I thought I'd take the opportunity while it was

still fresh in my mind.

Tonight I have what will be a quick and lame council meeting for my

complex. Then my, what is becoming, nightly conversation with R. It'

so wonderful to wish her pleasant dreams every thing. Thank you Skype!

This is a routine I'm really digging. Oh, and usually after we get off

the phone, I send her what will be her morning song to wake up to. I

love her reactions to the things I do for her. The other night she was

ending what was a bad day, so in an attempt to cheer her up, I filled

her in a couple of surprises I was working on for her. I know, it

wrecked the surprises, but I loved hearing her get happy with my

comments. Totally made my night.

Tomorrow morning I'm back up to Whistler to continue on the kitchen.

Probably this will be a few days. I'm actually looking forward to it

as I'm kinda enjoying the seclusion up there.


pharrell girlfriend is pregnant



Pharrell Girlfriend Is Pregnant!

Congratulations to Pharell of the Neptunes and girlfriend Vashti she

is pregnant with the couple's first child. I still think he is How you

doin!. Congrats

***Update***

Pharrell is not going to be daddy after all this was just internet

gossip. According to TMZ Pharrell and Vashti have broken up and he has

not seen her in over a year. Sources say Vashti has a new boyfriend


2007_09_01_archive



I'm sure time has actually slowed down in the past month or so. Maybe

Gordon Brown has made it a new Party Initiative for Jenny to Be

Constantly Reminded of How Long It Really Is Until Karl Is Home. It

seems like all I've been saying for goodness knows how long is "He's

home in 3 weeks". This time of '3 Weeks' will haunt me for the rest of

my life, as it doesn't seem to be getting any shorter! When will it be

2 weeks? When was it 4 weeks? It's been 3 weeks for as long as I can

remember, and the days on my calendar stubbornly refuse to cross

themselves off. September is officially the longest month of my year.

I have aged about 50 years and my blood pressure could rival that of a

fat kid playing poker while eating cake. I'm sure I have been going to

sleep every night, therefore waking up to a new day, and yet the days

in my diary don't seem to agree. Have I been going to sleep 5 times a

day, waking up convinced I should cross another day off my calendar?

The laws of time and patience are wearing thin with me, and I shall be

glad when this is all over.

But will I really be that glad? After all, this period of the past 6

months has done more to define our relationship than anything else

we've gone through. Since we found out he was being posted, most of my

thoughts revolved around 'Afghan'. Like the word 'Iraq', it has come

to mean so much more than a place. It means a place of hopelessness

and dust, political ideologies gone wrong, and a vast expanse of time

to be filled with keeping busy. Since he left to go to this hot

wasteland, my time has been filled with trying to make this time

easier for him, and everyone it affects. So I write letters, I send

parcels, I leave messages on his phone, I wait for him to get home. I

buoy his parents with talk of counting down sleeps, of plans for when

he gets home, and in being upset and weak I give them a chance to take

care of their son through taking care of me. But what happens when he

really is home and all this really is over? What will we talk about?

Will our relationship have any definition anymore? How can we ever go

back to normal after going through this; even though right now all I

want to do is 'get back to normal'. But what does that mean? Nothing

about living this army life is normal, everything teeters on the edge

of plans that can't be finalised, dates that won't stay the same, and

a vast gap between what they do and what they tell us they do.

Obviously we can get back to our idea of what a normal life is,

however that compares to civvy life, but I worry that without the

boundaries of this terrible experience, we won't know what to say to

each other.

Within this scenario of Afghan, he has his role of the big brave

soldier who needs a cuddle and I'm the heroine penning letters with

heartfelt sincerity. We know what to say to each other on the phone,

we know how far we can go with talk of wanting to come home (I say I

want him to come home, he says he wants to come home, but I don't push

it any more because we both know he can't come home and to point this

out would only make him feel worse), I know what things to report from

home (enough parties and family events so he knows I'm getting on with

my life, but not too much so he thinks I'm out partying every night

and getting to know his family better than he does), he knows what to

report out there (enough talk of patrols so I know he's working hard,

not anything which will cause my legs to go numb and to demand he

stays away from those nasty bombs), and The Future. That dangerous

murky path which has often caused those of the male species to retreat

in a cold sweat, insisting they need to be somewhere else. But we talk

about the future enough to make him feel like he's wanted back home,

like he has something to look forward to, but not too far in the

future to make him think I have used my free time to plan out the

small print of our lives forthwith. Getting all these balances right

is like walking a tightrope of awkward silences and nervous laughter,

of course not helped by the previously mentioned comedy phone lines.

It's nice when we have enough time on the phone to be able to just

chat, to hear each others voices without worrying about saying

everything you can remember from the past week. It's also a relief to

be reminded of how real they still are, they aren't just a voice on

the end of a phone line, as I was reminded earlier this week. When he

rang, after a few minutes I asked him if he really was okay, because

he sounded so miserable. he replied he was fine, he had just woken up.

Something about this reassured me so much, just knowing he had been

asleep, and had woken up, like I do every day. I had to remember he

was still himself out there, not a blank faced soldier, which made it

easier to talk to him again. It's important to be careful in what you

say, but not so careful you're tiptoeing round each other without

saying anything. I know this will be easier when he's home and we can

talk in person, but we'll need to be careful of other things we say.

So having to adjust to new balances and rules when he's home will need

some practice, just as he will have to practice not hitting the deck

when he hears fireworks.

It's apparantly 3 weeks until he's home for good, and I must say it

can't come quickly enough. I know one thing for certain though, I

won't ever take for granted the beautiful miracle of being able to

push some buttons on my mobile and hear his voice at the other end.

Posted by Treacle at 06:47 0 comments

Thursday, 6 September 2007

I've become very aware, and careful, about letting my guard down.

Lowering my defences and placing myself in situations of extreme

danger and adrenaline. I'm reading a survival/self-defence guide, not

for mountain bears or falling into foaming, gushing rapids, but for

the urban warrior such as myself. I consider myself a fairly

confident, cautious girl, especially living in London for the past

three years. Of course we were going to go out clubbing and pubbing

late at night, and who hasn't looked mournfully up and down the road

at the complete abscence of taxis and said "Oh come on, we'll walk."

And so on your merry way you'll go, laughing at the antics of the

evening, swinging your high heels from one hand and blithely unaware

that you've painted 'Victim' on your backside in neon paint. The whole

point of the book I'm reading, as instructed by an ex-bouncer who

could obviously take me, is to not put yourself in those situations at

all to start with. But if you have to, you must be aware of what is

going on around you, you have to know what signs to look out for, to

sense danger before it happens and remove yourself before you get

yourself in too deep. Sound advice, I hear you say, yet I am inbibed

with generations of inner strength and fighting skills passed down

from yonks before. Watching Bruce Lee films does not make you a

Kung-Fu legend, just as buying skinny jeans does not make you Kate

Moss.

Although these survival tips are, strictly speaking, for the outside

world of muggers and thieves, the advice on adrenaline and how to cope

with it still apply in other situations. You should never let your

guard down when you have a boyfriend marching around with rocket

launchers in a far-off dusty land inhabited by lots of other people

with rocket launchers. It's important to always stay in Code Yellow, a

stage up from completely switched off (Code White), and one step away

from Code Red (tying a bandana round your head and assuming fighting

position). Code Yellow is a heightened awareness of the dangers around

you, enabling you to see what lies ahead and hopefully how to cope

with it. Let me show you how I carelessly fell into Code White, before

being plunged into a situation I wasn't equipped to deal with:

It happened just like this last time too, when it got to the Six Week

mark. I got excited at the thought of him coming home sooner than it

was last week or the week before, and mapped out all the coming

weekends with the events I knew were going to happen, so in my head he

was practically on his way home. I thought, "Well this weekend I've

got that party, and next weekend I'll be working, and then I have that

doctors appointment, and then it's our anniversary, and then it's only

two weeks until he's back!" Having convinced myself the time will fly

so fast I won't even notice it coming, I always forget that I still

have to get through the next six weeks. Then I remember you cannot

swim that easily through Time, it has to be struggled through and

bargained with, overcoming small targets with the relief of a marathon

runner reaching the end. So I had unwittingly slipped back into Code

White, convinced he was safe and sound and would be home in time for

tea. Then of course, I was caught 'on the hop', as it were, when I

learned of the deaths of 3 British Soldiers just that day, only a few

hours ago, and the families had not yet been informed. I couldn't

control the adrenaline surge that befell me, as I wasn't on alert for

danger, and so Panicked. Reason couldn't take hold, only a dread that

crept cold and shaky up my spine and down to my fingers. Having called

a number that apparantly was there to help, and talking to a girl who

couldn't help me even if she had wanted to, I called his parents who

assured me there were no officials there breaking any news. So once

again I had to talk myself down and tell myself that if the officials

were with the families 'right now', it was safe to say that as we were

alone, The Boy might be alright?

Stressful times. I think I might have aged about 30 years in the past

5 months, what with all these near-misses and phone calls, and

snatches of news heard or seen in passing, and worried relatives, it's

a wonder we haven't all checked into rehab just for a bit of a rest.

If that bloody Amy Whinehouse can check herself in on a whim because

the endless cancelling of gigs due to exhaustion is so exhausting,

then I have definitely earned myself some air miles as far as stress

goes. I wonder if The Boy will ever understand just how worried we

were about him, constantly without rest. If he knew, he would write

every day, phone home every day, and possibly just come home. My

fingers are starting to hurt from clicking onto the same websites

every day with worringly regularity. I can't even imagine a time when

all this will be over, it's been going on so long. It's been at the

front of my mind ever since I found out he was going, which was last

year sometime. It'll be a hard adjustment to make when he's home and

never going back there, even though I'll still worry about hime all

the time. With him, I don't think I'll ever be on Code White again.

Posted by Treacle at 03:20 0 comments

Saturday, 1 September 2007

Helpless? Or Helpful?

I find it hard enough, as I'm sure most girls do, to know what A Man

Is Thinking At Any Given Time. As we sit on the sofa, having lapsed

into a comfortable silence, suddenly I start to wonder What He Is

Thinking. My brain whirrs and ticks, reaching no conclusions. Should

be be this quiet, is he sad or worried about something? Would he tell

me if he wanted to talk, or would he bottle it up and wait for me to

thrash it out of him? Maybe if I turn my head, very casually, I might

be able to see a well of emotion threatening to burst forth from his

somewhat casual position. I'd feel awful if he was struggling to form

sentences more meaningful than I could ever understand, while I remain

engrossed in Hollyoaks. And yet, could it be.....? Surely it isn't

possible....he's not thinking......anything? Sadly girls, this is

true. I'll let you into the secret that The Boy once told me quite

confidently: most of the time, he's not thinking of anything. Not a

sausage. And in all that time I've been working myself up into a

frenzy of sympathetic, hopeful silence, he really has been watching

Hollyoaks.

My point is, it's hard to know what another person is thinking. So in

the past week, having said goodbye to a good mate forever, and watched

his body take off into the sky to be flown home, no wonder he's a

little quiter than normal on the phone. I have never worried so much

about one human person in my whole life, than I have about him in one

week. It's been a constant, low-level nausea which remains present

night and day. I've been crying about anything, even catching sight of

the picture of us together on my table next to my bed every morning. I

want to make everything all better for him and I can't. I want to give

him a hug, and tell him I'm sorry his friend died, and that I'll

always be here for him. I want to make him a cup of tea in his special

mug, and toast just the way he likes it. I want to do all the things

that don't need words, because words are clumpy and awkward and can

get in the way. Coupled with a very bad phone line with a comical time

delay, it hasn't been the best time to make him feel better.

So what do girls do when they feel like this? I found support sites,

for Army Girlfriends where other girls share everything they're going

through, and Lordy, would I recommend it. (UkForcesGirls.co.uk) Girls

also shop. But not for me, for him. Wandering round Tesco's with a

trolley, throwing in everything I can fit in a parcel that isn't me.

(I tried once, but they said I was over the weight limit. I did

explain it had been Shephard's Pie night, so there might be some

discrepancies with my true weight, but they took a firm line) So we

had sweeties, chocolate, socks, baby wipes, DVD's, more sweeties,

photos, cards, more socks and a letter. I toyed with pants (Not

have to throw me out for that again), but dismissed them because there

was a scarily large amount of choice. I wrapped it all up in a big

box, wrote his address, my address, This Way Up signs, swirls and

stars and smiley faces, and marched it down to the Post Office. On

Pension Day. Whatever training The Boy has had, I want some before I

tackle that lot of ruthless pensioners again. Anyone would think I'd

taken all their Sanatogen. After moving very slowly up and down an

endless maze of barriers, I heaved the box onto the counter and asked

the bored, spotty young girl to send it to Afghan please. I definitely

said please, and continued to be as polite as possible, even when it

transpired I had to pay extra just to get it to London. Anything for

my man, I said, and handed over a twenty. I wasn't so impressed when

she, just as politely, gave me a five pence piece change.

Having poured my helpless, useless heart into that package, I searched

for other things to do, and I found there was nothing. I hated not

being able to do anything positive, except write e-bluey after

e-bluey, always telling him how strong he is, and how much I love him,

and it's going to be so soon until he's home with me again. I hated

that he might think I wasn't doing anything, and I couldn't even talk

to him to tell him how I felt. Until during a particularly bad phone

call, I made out through the muffles and pauses that every time he

thinks of me it helps him. Just knowing I'm waiting for him. And as a

smile spread over my face, I realised just how helpful I can be

without doing anything but waiting for him. It's that patience and

strength in my waiting that keeps him going, not anything else. Me

feeling helpless isn't necessary anymore, because every day that


russell simmons girlfriend looks like



Russell Simmons Girlfriend looks like an Older Rhianna

Hey Fashion Honey-- I was viewing my mentor blog "theYBF" when I came

across this pic of Russell Simmons and his new girlfriend. If you have

been on planet Mars for the last couple of months you would know that

Russell and Kimora Lee Simmons --Music and Clothing Moguls split up.

Kimora is now with Djimon Hounsou (talented Actor and one hell of a

sexy model-- Check Out his Calvin Klein ads). Russell bought-- I mean

brought his new girlfriend to the Keep A Child Alive Annual Black

Gala.


judge orders man not to have girlfriend



Judge Orders Man Not to Have Girlfriend

PETERBOROUGH, Ontario (AP) - A judge has ruled that a 24-year-old

Canadian man is not allowed to have a girlfriend for the next three

years.

The ruling came after Steven Cranley pleaded guilty on Tuesday to

several charges stemming from an assault on a former girlfriend.

Cranley, who has been diagnosed with a dependent personality disorder,

attacked his girlfriend in an argument after their breakup.

He tried to prevent her from phoning the police by cutting her phone

cord and punched and kicked her. He finally stabbed himself with a

butcher knife when police did arrive, puncturing his aorta.

Doctors say Cranley has difficulty coping with rejection and runs a

high risk to re-offend if he becomes involved in another intimate

relationship.

Justice Rhys Morgan said Cranley "cannot form a romantic relationship

of an intimate nature with a female person.

"That is the only way I can see the protection of the public is in

place until you get the counseling you need."

Cranley had already served 146 days in pre-trail custody, which Morgan

said was enough jail time in this case.


im great girlfriend



Im a great girlfriend!!!

You are a Great Girlfriend

When it comes to your guy, you're very thoughtfulBut you also haven't

stopped thinking of yourselfYou're the perfect blend of independent

and caringYou're a total catch - make sure your guy knows it too!


minnesota police officer gets probation



Minnesota police officer gets probation for harassing former girlfriend

Duluth, Minnesota, police officer Craig Johnson has been sentenced to

one year of supervised probation, ordered to abstain from alcohol, and

attend panel discussions on how victims are affected by violence and

domestic abuse, after being convicted last month of harassing his

former girlfriend.

Johnson, a Duluth officer for over 20 years, was accused of making 119

obscene or harassing phone calls during a five-week period last year.

31 of those calls occurred while he was on duty and 15 of them were

made from a city of Duluth cell phone.

He could have faced 90 days in jail and a fine of $1,000. (Duluth News

Tribune)


your russian girlfriend is not dear




Sunday, 24 February 2008

beauty and beast fantasy girlfriend and



Beauty and the Beast, Fantasy Girlfriend, and some other stuff

So Sunday my ma, my bro and I went to my school to watch a production

of Beauty and the Beast. it was not my school's company doing it, but

a christian youth group from around here. i drove in my car. riding

with my parents is always strange because somehow i can manage it fine

without their assistance...till they get in the car with me. i was

going up river street, near where my father's work is, and this little

white car pulled out in front of me. it was close, but not extremely

close. i let my foot off the gas so i wouldn't hit it.

"PUT ON YOUR BRAKE! PUT ON YOUR BRAKE!" my mother said. i did so to

appease her. then she reached her arm in front of me, feeling around

MY stirring wheel till she found the horn button and then blew the

horn several times at the driver of the white car.

I didn't say anything about it to her, but it did get under my skin a

little. I didn't appreciate it.

The show was okay. several things i would have done differently if i

were in charge of it, but that's neither here nor there. beauty's name

was belle, just like the disney. the whole thing was based off the

disney movie but they did different songs and changed some of the

characters' names to avoid prosecution, i guess. belle's father

sounded like kel from kenan and kel, an old show that used to come on

nickelodeon when my brother and i were kids. when the beast turned

back into a human, his microphone went dead, and we could all see his

mouth moving but couldn't hear him singing. and the girl who played

belle looked very much like nancy mckeon.

i was in 10th grade and watched nancy mckeon in facts of life reruns

and this show on lifetime called the division, where she was a grown

up cop. i liked the young version better cause she was more tomboyish

back then and i wish she went to my school. my mother was like, "i

don't get it, what's the fascination with her? i could understand it

if she were a BOY!" oh...them was the dayz...anyway, fantasy

girlfriend, nancy mckeon:

I made a A- on my Frida Kahlo paper. Mostly the deductions were

because of errors in my MLA format, which i knew there would be some

cause i didn't look up the format and relearn it, i just went from my

rusty old brain. but it was a good grade.

so today...Melissa's new cd comes out. when i am finished with my work


my son and his jedi mind tricks



My Son and his Jedi Mind Tricks

So while readin jden's fab blog...I came across her post about her

son. This got me to thinking about recent events in my house...

My son is smart and extremely creative...he can learn new things

without effort. He can do just about anything he sets his mind to

do...if only he would use his powers for good! I'm thinking about

surgery, 'cause there must be a calcified ulcer on his "truth gene".

He is able to tell lies and manipulate like a champ. Let me tell you

'bout the Jedi mind trick he played on his science teacher...

My son has basically been on chill mode in school. This is his first

year on the school basketball team. So now he a "balla" right? He

skinin' and grinin' with his team members after school when he 'sposed

to be in study hall doing work. He lyin' bout homework and

assignments...so his grades are in the toilet. So he 'bout to git his

black azz "traded" off his basketball team and kicked out of his

advanced placement program...Not good. Sooo his clever azz tells his

bleeding heart science teacher, who thinks Babyboy walks the water,

when he asks, "What's going on, is there a problem...at

home?"...Babyboy goes into full "tiny violin playin'" mode and jumps

at the opportunity and tells the teacher, "yes, that's it,

problems...at home even!"... Yes? What? Like a fish taking bait, he

goes..."Well my mom used to work for a law firm but it went out of

business (he left out the part that that was 2 years ago), then she

started her own practice. She is thinking about working from

home"...So ScienceGuy decides since "he" is having problems at home,

to "work" with his azz. Babyboy might as well have put a swinging

piece of jewelry in front of ScienceGuy's face and said, "You are

gettin' sleeeepy, when I snap my fingers you will be under my

controoollll..."

So, he gets a pass! No getting benched, no getting put out of advanced

placement...nothing but sympathy. For what? Because I'm unemployed?

What the fu*k?! What that got to do with him? His lifesteeloo ain't

changed. He ain't got to pay no bills. He ain't got to rob Tyrone to

pay Tyreek. This ain't no poor kid trapped in an after school special

(Ya'll remember those shows!). He don't have to go to the sweatshop

and pump out 114 knock off bags before noon and sleep on a cot in the

back to make $1.25 per hour to send back home. He done played them

fools at school!

So I find out by mistake that all this has been said. I show up at the

science teacher's room to drop off a science fair project that we

slaved over for days (when I coulda been reading a book or bloggin').

The science teacher is all nice and like, "Hey did Babyboy tell ya

that we had a conference and everything's o.k...wink, wink..." I'm

like, "What are you talking about." I know his grades were nasty. I

know he is on punishment. I know his Dad had an, umm, "talk" with him.

But I do not know what this man is winkin' and talkin' 'bout. So he

tells me all about how him and Babyboy had this "talk" about the

situation at home...you know about the problems he's having at home.

Situation? Problems? What are you talking about. He says you know with

your practice.... He says Babyboy told me 'bout you closing your

practice and all. I'm looking at the science teacher like "What that

got to do with Babyboy?" and he lookin' back at me like...(long

pause)..."Well, I don't know mam" all confused and discombobulated

like. My ears are ringing now, 'cause my presha done gone up. I can't

hear this man talking anymore and the room is spinning. Babyboy got me

out here bad. I am having a video in my head of me attacking Babyboy.

The video is called something like "When Mommies attack"!

I wanted to tell that dummy, "well, Sir, it wasn't any problems at

home `fo you told me what this knucklehead done said, but there

definitely is gone be some problems at home now...."

So later, in the hall when I'm walking him to class, I'm like what did

you tell this man? And he says some dumb stuff like he asked me what

was going on at home so I told him that. I'm like what that got to do

with you and your grades? He just looks at me..."I didn't tell him

that it had anything to do with my grades...(he's about to cry, cause

he can see that glazed look in my eye)! I go, "Then what was the point

of telling him that?" He just basically looks at me and says nothing

that makes any sense...I walk away before I crush him.

So now I got a psp, a playstation, a bunch of video games and a cool

new phone...'cause Babyboy is on lockdown...

***Girlfriendtionary...For those of you who don't know, now you

know...

Jedi Mind Trick (per Wikipedia) In the fictional Star Wars universe,

the Jedi mind trick is a Force power. Jedi who know the power can, by

using the Force, influence the actions of other "weak-minded" sentient

beings.

Jedi typically perform this ability with a wave of the hand and a

verbal suggestion (for example, "These aren't the droids you're

looking for"). If the trick is successful, the victim will reply by

restating the suggestion ("These aren't the droids we're looking for")


what kind of girlfriend am i



What Kind of a Girlfriend am I?

just in case you're wondering... Tickle says I am this:

Aileen, you're a Steady Supporter

Stand by your man -- that's just something you naturally do. Once

you've committed to a relationship, you are a constant companion who

enjoys the comfort and stability that comes from being a couple. Not

quick to judge, accuse, or think the worst, you have a lot of trust

(in him and in yourself), and you rarely worry about where he is or

who he's with.

For you, mutual respect is of utmost importance. You are comfortable

and confident in your own skin, making you a great pillar of strength

in all your relationships. Whether he's striving to climb a mountain

or land a promotion, you have his back. Best part is, you know he's

got yours too.

As told by aYi @ 08:14

_________________________________________________________________

About

my sanctuary of thoughts... playing between the line of crazy and

sane... where I reveal almost everything there is to know about me...

where I surrender myself to the world...

About Me

My Photo

Name: aYi

Location: Makati, Philippines

A quiet person who likes spending time alone (but still enjoys hanging

out with friends). Not good in talking, so I speak my mind through

other means (blogging works best for me). Moody but fortunately very

transparent, so anyone can easily tell what mood I'm in. Complicated

because I think too much. I always tend to overanalyze things. That's

why making decisions, even the simplest ones seems hard for me. Drama

queen, I cry whenever I feel extreme emotions. Be it happiness, anger,

pain, depression, sorrow, frustration, etc. Been in love so many times

and been burned so many times as well. But each unique experience

taught me a lesson. The greatest one so far, I learned is from the

last person I have loved. I have learned that you should never hold

anything back in relationships so you will have no regrets in the end.

I believe that love does not end in death because I think my love

continued to grow further though he is no longer in this world. To

know enough so you can stalk me, you can just check out my blog here

and on http://aisevs.blogs.friendster.com.

View my complete profile

Previously...

* Tickle's Inkblot Test

* Surgical Pathology Consultation Report

* Follow-up to Stitch Up 2

* Stitch Up 2

* Snowglobe Update

* Year-Ender Post 2006

* No Explanations

* Guess Who Stole Christmas?

* Greetings!

* Attention: Gift-Givers

Powered by Blogger Weblog Commenting and Trackback by HaloScan.com


video 34 matthew sweet girlfriend



video #34: Matthew Sweet - Girlfriend

All I wanted was to just listen to "Girlfriend" -- mainly for the drum

break that comes in at about the three minute mark -- but didn't have

the song and figured the fastest way to hear it would be just going

straight to Youtube. I wasn't even going to watch the video, but hey!

It's animated! At first I thought it was just another AMV mistagged as

the "real" video, one of hundreds or more floating around in the

oversaturated sea of fan-edits on the site. But Mr. Sweet's mug

popping in at 0:38? Yikes. Wikipedia confirms this is the real video

for the song, though if I'd had MTV as a kid like everyone else, I'd

have known this already.

The anime used for the video is Space Adventure Cobra, which one

review describes as "prime late-night material" for MST3K fans. An

obscure title today, though I'm sure it wasn't an easier for Americans


how to be perfect girlfriend




6 gifts you should never give your



6 Gifts You Should Never Give Your Girlfriend

Its your girlfriends birthday or your first Christmas together, and

really understand her. The wrong one, however, can tell her just the

opposite. Dont get stuck in her Bad Boyfriends Book of Records. Heres

Exercise equipment. Nothing says, I think you could stand to lose

weight like a Stairmaster. The same goes for a set of barbells, a

Pilates instructional video, or a gym membership. Even if shes talked

like her body the way it is.

If you really would like to see her exercising more, lead by example.

Join the gym yourself. Chances are, when she sees how great you look

and feel, shell be inspired to join as well. You could also take up a

physical activity you could do as a couple, such as cycling, jogging,

or hiking. To increase the chances shell get into it, pick an activity

shes expressed interest in before. It should also be one you can do

relatively easily. Dont decide to take up sea kayaking if youre two

hours drive from the ocean, for example, and dont pick one that you

need a lot of expensive equipment to get started in.

Cookware. The subliminal message here is Get in the kitchen and make

interest in cookingor if youd like her to. If you have a master chef

for a girlfriend, its especially important to pass on this kind of

high-level cooks are picky about their equipment.

If you really would like to encourage her to cook more, start with

some positive reinforcement. Praise the meals she does cook. If you

tell her you see her as a great cook already, shes more likely to take

more of an interest in the culinary arts.

A vacuum cleaner. The same goes for feather dusters, mops, bottles of

Pine-Sol, oven cleaner, Lemon-Scented Joy, and any other household

maid than a girlfriend.

adorablebut theyre also a lot of work. Food and vet bills can be

expensive, and many pets require a change in lifestyle to take proper

care of. For these reasons, its best not to surprise your girlfriend

with a new pet.

Part of the fun is choosing the pet yourself. If your girlfriend has

told you she wants a dog or cat, offer to take her to the local animal

rescue shelter instead and pay for the pet she picks.

Something you want for yourself. You know youve been tempted to buy

her that subscription to Fly Fishing magazine, new set of golf clubs,

or Playstation II. Dont do it! Shell see through it instantly.

Jewellery. Jewellery has a great deal more meaning for most women than

youre the right guy for her. If you get it wrong, however, at best

shell laugh about it with her friends for ages. At worst, she could

see it as grounds for doubt about the relationship. If youre going to

give her jewellery, youd better get it right the first time.

What makes giving jewellery so difficult is that every woman has

distinct tastes. The jewellery you pick could be too chunky, too

eccentric, too classic, too delicate, too cheap-looking or

expensive-looking for her. Some women never wear gold, some never wear

silver, and most women have a preference for certain precious stones

over others. If you really do want to give her jewellery, casually

take her into a few stores. See how she reacts to the merchandise.

Make note of any pieces she especially likes. Then go back later to

buy them.

diamond bracelet tells her you see her as precious and beautiful.

Elegant lingerie can tell her you see her as sexy and desirable. A

book about something she finds fascinating tells her you take her

interests seriously. However, its important to take her unique tastes

into account before buying her any present. If you do, and if you

Janette Vince is managing director of http://www.thanksdarling.com a

http://www.thanksdarling.com.Child Birthday Party Nj

Dish Minneapolis Network Satellite Tv

Azul Hotel And Beach Resort Mexico

Truck Driving Song

0 Balance Transfer

Professional Cosmetic Train Case

Truck Driving Paid Training

Bank Chase Chevy Online

Kt176

Machine Snack Soda Vending

Sunday School Crafts

1 16 Deere John Toy

Kt183

E Stim

After Birthday K Party Sing

Basketball Purple Shoes White

Nursing Rate Retention Travel

Boom Box Radio Satellite

Egypt Woman Clothes

1 Pip Spread Forex Trading Platform

Clairvoyant Psychic Freel

Charmglow Free Gas Stove Vent

Allen Elementary School Southgate Mi

Buy Elmo In Stock Tmx

Spirit New York Club

Global Warming In The Future

Collecting Gun Toy Western

Kt82

High Heeled Man Boot

X Plane

Wholesale Man Dress Shirt

Personalized Baby T Shirt

Female Body Building Blog

Uk Oriental Carpet

Distance Houston Long Phone Service

Kt60

Hotel Sardinia

Camelia Oil

Snow Mobile

Furniture Shows

College In South Georgia

Hempstead New Car Price

Plastic Bag Company

Detox Diet Uk

Crystal Drinking Water

Celebrity Gossip True

Loan Mortgage New Refinance York

Park Place Inn

Equipment Office Product

Perl Wait

University Of Maryland Medical School

19 Century French Chaise Lounge Day Bed

The Day The Earth Stood Still

Dinner Party Invitation

Kt125

Earring Heart Name

Venician Las Vegas

Saint Paul

Chinese White Tea

Atp Tennis Result

Ipod Wall Charger

Warren Thompson

Kt89

Dating International Russia

Bargain Dakota Online Shopping South

Camcorder Camera Concord Digital Video

07 2006 Almanac Farmer Outlook Winter

Chrome Wallet Chain

Kt110

Career Fashion

Diego San Wedding Yacht

Dance Dance Revolution Mat X Box

Accra Ticket

Sacramento Wedding Photographer

2 Microphone Play Sony Station Usb

Kt45

Beyond Sea Soundtrack

Dominican Republic Vacation Villas

Property Tax Sales

17 Boat Sail Venture

Christian High School Diploma

Romantic Adult Gift

Web Positioning In Directory

Cosmetic Free Mac Shipping

Petersons Culinary Schools

Mobile Home For Sale Mn

Careers In Event Planning

Activity Baby Discover Einstein Gym Play

Fort Worth Laser Eye Doctor

Massacre 50 Cent

Tucson Motorcycle Accident Lawyers

Hard Rock Cafe Atlanta Ga

Field High Hockey Michigan School

Breakfast Nook Cushion

Pictures Of Scooby Doo

Radio Era Fm

10 Essential Forex Trading

Cheap Cyprus Flight Poland

Bed And Breakfast Minnesota Anoka

Beaded Costume Gold Jewelry Necklace

Chaise Ladas

Flight London To Rome

Custom Made Hiking Boot

Chocolate Labs For Sale

Handel On The Law

Kotler Management Marketing

Gateway Shopping Center Austin

Family Choice Health Insurance

Houston Dealers

Mesotheloma Malignant Pleural Mesothelioma Crocido

Car Dealer Johnstown Pennsylvania

Black And Decker Repair

5 Guide Guide Guide Peru Rough Rough Travel

1600 Love Sailing Ship True

Mens Travel Wallet

Eureka Deep Steam Carpet Cleaner

Nursing Tennessee Travel

Kid In Gym

Boulder Dushanbe House Tea

Knotts Berry Farm Hotel And Resort

Lobster Maine

Band Pepper

Dark Collection Bbs

Highest Paid Basketball Player

Dating Mtv Next Show

0 Car Deal Finance New

Kt46

02 Bikers

Cheat Crystal Game Pokemon Shark

4d Draw Pool Result Singapore

Food Vending Cart

Albeta Business Sellin Drug Detox Products

Federal Employee Blue Cross Blue Shield

Rude Comebacks

Cross Job Training

Detox Solution For Marijuana

Xmas Countdown Clock

Allowed Apartment Finder Pet Pool

06 Can Dance So Think Tour

Jump Pool Shot

Pleasant Holidays Vacation

Vegetarian Indian Snacks

Black Websites

Air Bag Module

Password Pc Satellite Tv

Time Share Rental In Las Vegas

Car Part Truck

Kt38

Furniture Harlem Lombard Store

Cherry Bikini

Sea Salt Scrub Recipe

Copacabana Night Club New York

Nike Polo Shirt

Roxy Travel Bag

Flat Panasonic Panel Television

Matthew Shepard Story

Satellite Dish For Buy Free Air

Vitamin Supplement Store

03 Sea Doo Sport Boats

Paris Hotels 5 Star

Non Ferrous Scrap

Lou Fusz

Child Grinch Costume

Northwest Flight Attendant

Hiking Kauai Photo

Dance Purdue Team

Mens Tall

Lane Kid Furniture

Mlm Health Network Marketing

068 Coat Dog Healthy Skin Ww

Truck Driving Schools In Georgia

Cape Verde Africa

Loretta Paganini School Of Cooking

Club Health Palisadium Spa

Warehouse Lifts

Political Crime

20 Breakfast Lyric Matchbox Tiffanys

Mimis Cafe Restaurant

This That

Chat Free Video

Wood Home Depot

Airline Employee Discount Travel

Decoration Flower Table Wedding

7 Adobe Download Free Free Ware

Free Cyber Cafe Management Software

Absolutely Dating Free Online

Trends Customer Relationship Management

Cheap Authentic Jordan Shoes

Oklahoma City Drug Abuse Detox Centers

Metal Gear Solid Substance Xbox

Apartment House Nj Rental White

Power Access

Dining Room Furniture Uk

Global Not Real Warming

Buy Flower Where

Retiring In Ecuador

Valley Fair Shopping Center

10w 11 12v Halogen Lamp Mr

Hobby One

Compensation Mesothelioma

Sky Decoder

1 Bowl Depression Dust Great

Ball Crystal Question

Apparel Baseball Tiger

Portland Grotto

Atlanta Ga Home

5 Star Hotels Raleigh

Boxed Holiday Card

High Protein Vegetarian Recipe

Care Kay Mary Product Skin

Bike Mountain Part Trek

Medical Office Policy And Procedure

Table Tennis Table Top

Christmas Gift Kid

Animadas Cartoon Huevo Postales

Most Popular Holiday Gift

Murray Riding Mower

Com Layout Myspace Myspace Site

Colorado Lawyer Litigation

1 Ad Review Supplement

Dish Guide Network Television

Age Danlos Directory Ehlers Internet Official Patient Revised

Sourcebook Syndrome Updated

Kt167

East Kentwood Hockey

Kt145

Department Health Public Toronto

Motul Motor Oil

Antenna Klm Satellite

Wwe Toy Accessory

Sterling Silver Tea And Coffee Set

06 Can Dance So Think Tour

Losing Weight While Pregnant

Business Complaint Letter Write

100 Dating Free New Online Zealand

Laos Arts And Entertainment

Ontario Man Hockey Tournament

Las Vegas Time Share For Sale

Psychics Colorado

Bird Feeder Humming Make Own

Contractor License Cdroom

Home Improvement Loan Online Secured

Dining Food Restaura Restaurant Vegetarian

Laxative Use

Pinay Celebrity Scandal

Brew Pub And Sportsbars

Dealer Hot Master Spa Tub

Kt65

Car Wreck Cartoon

Power Twister

Newspaper Obituary Post Washington

1 Beauty Fitness Health Mark Mf

Ipod Media Reader

Kt159

Blackwork Embroidery

Teal Bend

Ab Ball Stability Workout

Cool Pool Game

Agent Become Estate Ontario Real

Boot Discounted Ugg

Review Of Ilo Television

Apartment Boston End South

Montreal Hotel Online Reservation

Online Hockey Store

Rainy Dayz

0 Down Payment

Atec Casey

Kt181

Pen Driver

Panama City Beach Condominiums For Rent By Owner

100 Estate Real Remax

Aruba Share Time

Honda Front Clip

Bargain Jewelry Man Product Watch

Curious Labs Poser

Celebrity Crib Episode Mtv

Baseball Bat Combat

Child Invitation Party Printable

Pittsburgh Shopping Center Mall

Free Online Crm

Bank Of America Interest Rates

Ritz Carleton Hotels

Taffeta Flower Girl Dress

Brown Gas History Offshore Offshore Oil Pioneer Root

Coffee Machine Vending

Airline Online Sales Southwest Ticket

Kids Fighting

Garden International Ornament Show Trade

0 Blood Diet Type Type

Apartment City Furnished Panama

Ontario Reverse Phone Directory

Direct Satellite Setting Tv

360 Xbox Charger Skin X

Basketball Maryland Woman

Bed Breakfast California In Southern

Used Jewelry Display

Soundbar Night Club Chicago

Universal Spa Supply

Cost Of

Easy To Make Angel Costume

Deskjet 842c

Kt167

Ante Natal

Pharmacist Job Description

070185b Filter Generac Oil

Used Pool Table In Illinois

06 07 Card Hockey Mcdonalds

Alergyst Doctor Immonologist Skin

Dance Clubs In Atlanta

Cyprus In Villa

Baby Bed Doll Wooden

05 Mustang Performance Parts

1 16 Deere John Toy

Business Plan School

1 Dog Hot Job Part

Fitness Life T35

Mad World Song

03 Jetta

Alternative Medicine Schools

Selling Of Dart Supply In Vending Machine

Table Tennis Racquet

Baby Gift Personalized Toronto

Superman Lava Lamp

Cheap Apartment In Houston Tx

Georgia Law Regulation

Diamond Earring Online

Boot Hiking Leather Womens

007 Agent Under Fire Xbox

0800 Free Phone Number

Pericardial Mesothelioma

Career Development Goal Objective Personal

Gary Coleman Loan

Mineral Based Industry

Black Braid Hair

Editor Myspace Thomas V3

Nursing Internships

Ohio State Polo Shirt

Wireless Connection

Dbz Music Video

Customer Relationship Management De

Psychics Ms

Restaurant Cafe Cafeteria

Syria News

Interest Only Mortgages Georgia

Garden Sculpture Socrates

Bar Chocolate Oatmeal

1 Tag Fur Verliebte

Antique Gold Indian Jewelry

T Mobile Cell Phone Directory

Petro Canada Calgary

University Of Georgia Athletic

Boat Construction Hull Plan Sail

Contractor Contractor Employer Employer Guide Guide Hiring Independent

Independent Legal Legal Working

Kt132

07 3 3 Animal Episode Planet

Grocery Smith Store

Chinese Celadon

American Savings Bank Hawaii

Epcot Space Ship Earth

Career Change Teacher

Table Tennis Blade

Rangoon University

Hearty Beef Stew Recipe

Attorney Malpractice Medical Nj

Long Island Ny House For Rent

4 Bedroom Orlando Villa

Simply Clinique Perfume

Eagle Ticket Falcon

Attorney Birth Injury Wisconsin

100 Cd Drum And 20 Cd Wallet

Direct Email List Marketing

Prostate Massage Movie

00 Biocryst Price Share Us09058v1035

Online Office

Nutritional Protein Supplement

Luna Caprese

Espn Football Monday Night Radio

1 Astrology Encyclopedia Medical Part

Fiesta Barbecue

Braun Coffee Makers

Teeth Whiter

0 Automobile Financing

2007 Time Share Calendar

Kt133

Sports Chalet Location

Nike Basketball Shoes For Woman

Ventura County Ca

Vice Squad

Online Psychics Wanted

Bed Bunk Playhouse

Fee No Sell Share Time Upfront

Beach Destination Florida Wedding

06 House

Buns Dog Hot In

1 Anniversary Gift Idea Wedding Year

Kt53

Build Rack Truck

Fishing New Top Trout Water Zealands

Kt110

Direction Direction Driving Map

Basket Christmas Gift Tea

Cycle Dallas Equipment Fitness Life

Kt174

Refinance Home

Kt8

30 Ipod Skin

Kt169

0 Car Deposit Finance Uk

Hours Office Post Saturday

Graphic Halloween Layout Myspace

Fashion Magazine Man

20 Dating Free Personals Site

J T Money

Preventing Global Warming

Girl Pajamas Party

Discount Hobby Store

0 Apr On Cash Advance

Fountain Garden Resin

Credit Check

Ballroom Magazine Rock Star

Bed Lounge

African Food Chain

Basketball Carolina Man North Tarheels Ticket

Global Warming Pros

Kt48

Bidding Construction Jobs

06 Pro Tennis

Kt45

Employment News Online Job Opportunity

2006 Award Mexico Mtv

1 6 Book Law Plato X

Signature All Inclusive Vacation

Nintendo Game Cube

Restaurant New York

Potomac Job Corps

Play Crystal Maze Free

Apple Vpn Client

Opeth Concert Tickets

Ashland Consulting Internet Marketing

Club In Night Orlando Tabu

Body Dealing Liberated Life Living Pain

Flower Service

Try These Handicraft With Water Crystal

1 Harpie Lady

Kt114

Fun For Girls

Custom Golf Cart For Sale

Health Safety And Welfare Regulations

International Office Team

Disney World Florida Vacation Package

Virtual Textbook

Fredericton Hotel

Florida Mortgage Properties

Commercial Estate Houston Real Tx

Chapel Houston Tx Wedding

Care Child Infant Job Mn Near Opening Paul St

Justin Cowboy Boot

Airline China Ticket

Putting Out A Gasoline

Crystal Light Drink

Download Elise Free Fur

Quote From The Tv Show Friends

Khs Bicycles

Picture Of Jesus Birth

Job Loss Mortgage Insurance

Home Office Layout Design

Television Retail

Colorado Real Estate For Sale

Celebrity Dos Hair Wedding

Crystal Himalayan Lamp Rock Salt

Car Game Game Racing

Milliken Commercial Carpet

1 1 2 Story House Plan

Free Magazine Sport

Customized Free Plan Workout

1 Anniversary Gift Wedding Year

Tennis Court Dimension

Remax Real Estate Oregon

Myrtle Beach Web Cam

Cheap Renters Insurance

007 Agent Under Fire Xbox

The Blade

Kt35

007 Nightfire Cheats

Arroyo Pet Care Center

0 Points

1950 S Designer Leather Chaise Lounge

Authorities Sports Store

Galle Lamp

Coin Jewelry Silver State United

Book Handicappers Sport Vegasinsider

Bedroom Collection Furniture International K Mfpalp Modus

Citizen Farmer Bank Cole Camp

Hikers Backpack

Allen Bike Rack

Third World Press

Hot Dog Vending Cart For Sale

The Forks Winnipeg

Itunes And Ipod Help

2006 Almanac Farmer Winter

12 Volt Wholesales

Bucket Garden Loader Tractor

1 Tag Fur Verliebte

Antique Chocolate Collector Guide Mold Values

1 Com Internet Marketing Promotion Services Site Web

Ipod Mini Canada

Nashville West End Apartment

Camper In Pickup Slide Truck

Santa Fe Public Schools

School Bus Driving In North Carolina

1 1 2 Story House Plan

3 Baby Free Stuff

Cottage Design Green House Living Self Small Sufficiency

0 Car Financing

Hiking San Diego County

Care Cosmetic Shiseido Skin

Weight Lifting Body Building Routine

Area Bay Clairvoyant Francisco Healer San

Disney Guide Luxury Walt World

Nj Attorney General Guidelines

Golf Pro And Tennis Hos

Bulk Email Marketing Lipo

Sony Trinitron Televisions

Association Condominium Ontario Toronto

Christmas Flower Pot

Chocolate Cingular Pink

Dance Dance Ddr Revolution

A Inside Basketball Hoop

Cake Making

Louis Vuitton Mens Wallet

Sales And Marketing Executive International

Drive Thru Wedding In Las Vegas

German Shepherd Dog Breeding

Nextel I1000

Obituary Frederick Maryland

Dr Jeanette Graf

24 Hour Fitness Trainer

Compatible Download Ipod Music

Boot Child Horseback Riding

Tina Rigdon

07 Toyota Truck Tundra

Battery Cell Motorola Phone T730c

02 Sim Card

Sing Along Christmas Carols

007 Box Set

Card Coffee Gift Starbucks

1 Bethlehem Christ From Jesus Life Mount Sermon Teaching Through

Volume

Dark Angel Costume

Kt77

Kt179

Animal Baby Know Mother Their

11th Club Copacabana Night Nyc

Luxury Villa Italy

Bread Recipe Simple White

Ipod Tune Free Audio Fm Transmitter

Tobacco Chewing Cessation

Marriott Time Share Miami Doral

Hotels Hossegor

Disney Snow White Picture

Dotnetnuke Active Directory

Best Career List

Christ Church Jesus Lord

Miami Boat Rental

Business Down Money No Start

Film School Top

Tamper Proof Fasteners

Country Inn Minnesota Rochester Suite

Vitamin Discount

Care Jan Marini Skin

Jimmy Buffets Margaritaville

Drop Leaf Farm Table

Westin Casuarina Hotel And Spa Las Vegas

Mercy Medical Center Baltimore Md

50 Hike In Jersey New

10 Best Place Retire

Peterbilt Truck Used

1 Anniversary Gift Idea Wedding Year

Reason To Date A Hockey Player

Fast Cash Payday Loan Emergency Loan Quick Loan

Gemstone Baltic Amber Gold Earrings

California Water Resource Board

09 Bird Tattoo

To Either Reduce Or Eliminate The Problem Of Global Warming

Villa Del Sol Corpus Christi

Wholesale Jewelry Catalog

Life Mtv Tourettes True

Dance Apparel Warehouse

Data Downloads

Colorado Hike

06 Cup Soccer World

Accounting Annual Concept Financial Fundamental Report W

10 Karaoke Song Top

Hsbc Call Center Philippine

Dream Night Club In Dc

Snow Guards

Bathroom Furniture Ireland

Wedding Table Idea

Atlanta Computer Service

Arizona Reception Scottsdale Site Wedding

Oolong Tea And Weight Loss

0a Care Career Health

9:39 PM | Permalink

Post a Comment

[]

About me

* I'm marcyng42738

* From

*

My profile

Previous posts

Archives

* Jan 29, 2008

* Feb 1, 2008

* Feb 2, 2008

* Feb 3, 2008

* Feb 4, 2008

* Feb 5, 2008

* Feb 7, 2008

* Feb 9, 2008

* Feb 10, 2008

* Feb 11, 2008

* Feb 12, 2008

* Feb 13, 2008

* Feb 15, 2008

* Feb 16, 2008

* Feb 18, 2008

* Feb 20, 2008

* Feb 22, 2008

* Feb 23, 2008

Links


hey you i dont like your girlfriend



Hey, you! i dont like your girlfriend!

congratulations to the UP Pep Squad for winning the UAAP Cheering

Competition. :-)

congrats din kay Jahan (groupmate kong nagkakasakit na dahil sa

pagsasabay ng acads at pep(drummers))! yey! haha.

okay.

Ubuntu Linux study-- in progress. we need 30 people to participate in

our HCI evaluation.

where would leslie and i get 30 people?

we need people from Engg. dapat different colleges. sige, magtetext na


girlfriend in coma



Girlfriend in a Coma

I begrudgingly went to see a Smiths' tribute band, called Girlfriend

in a Coma, at the State Theater in Falls Church, Va., on Thursday

night with Lily. Although I was reluctant to go, I had a pretty good

time of it by the end of the show! (Lily, by contrast, was giddy from

the first note of the first cover song...)

See, this fellow Christopher Quinn of DC does a pretty mean Morrissey

impersonation. He doesn't look anything like the man, but Quinn's

height and hairdo help him in performing some pretty impressive moves

from Moz, down to the dance style, rolling on the ground, the mincing

steps and the overall preening. The whole show is really about him, as

he croons his way through an assortment of songs from The Smiths from

across their career. The rest of the band, which includes several

members from Baltimore 80's cover band The Reagan Years, simply plays

on and lets Quinn do his thing.

And do it he does. The audience gets into it with women throwing

flowers at him and stage invaders leaping up to give the guy a hug.

Even the most skeptical Smiths fan has to bust out a smile or two and

dance along to "This Charming Man," "Heaven Knows I'm Miserable Now,"

and "William, It Was Really Nothing," as Quinn yelps out a darn

convincing performance, all things considered.

About 200 people showed up at the State Theater for this and they all

had a good time. The cover was $11 a ticket, which was a bit much for

a tribute band. On a related note, maybe it's time I considered

changing the name of this blog to "People Who Listen to The Smiths in

DC" or something. (On another related note, we noticed that Ottobar in

Baltimore actually hosted Smiths/Morrissey karaoke that night! How


man that shot girlfriend yesterday



Man that Shot Girlfriend Yesterday Turns Himself In

At around eleven this morning, the man accused of shooting his

girlfriend in the back of the head during a domestic dispute, has

turned himself into authorities. Reginald Smith has yet to be charged

with a crime; Escambia County Sheriff's deputies want to interview him

first.

The suspect has a history of criminal activity. Last April, Smith was

released from prison after serving a six year sentence.


leo has new younger mannequin



Leo has a new, younger mannequin

DiCaprio has moved on from supermodel Gisele to a younger carbon copy,

Israeli model Bar Rafaeli (above) They have been dating since

December. A source said, "He is totally in love."


nfl players girlfriend arrested



NFL player's girlfriend arrested

Source

PITTTSBURGH, Pa., Jan. 20 (UPI) -- A woman was arrested Sunday

following a nearly 12-hour standoff at a suburban Pittsburgh house

owned by wide receiver Cedric Wilson of the Pittsburgh Steelers.

The woman, Lindsey Paulat, identified as Wilson's girlfriend, had

fired two gunshots inside the house in the Wexford area north of the

city, the Pittsburgh Post-Gazette reported.

Wilson was not in the house during the incident and no one was

injured, police said.

"It ended peacefully," said Robert Amman of the Northern Regional

Police Department, the Pittsburgh Tribune-Review reported.

Police said the woman and Wilson had argued before he left the house.

She was distraught and threatened to harm herself, the Tribune-Review

said.

Occupants of nearby homes were evacuated during the standoff, which

ended shortly before 1 a.m., police said.

Wilson could not be reached for comment.

"He's OK; he's fine," Steelers spokesman Dave Lockett said.swollen


crazy ex girlfriend



THE_URL:http://in-my-music.blogspot.com/2008/02/crazy-ex-girlfriend.html

THE_TITLE:Blogger: 404 Error - Page not found.

Blogger

Push-Button Publishing

Page Not Found

The requested URL was not found on this server. Please visit the

Blogger homepage or the Blogger Knowledge Base for further assistance.


re your potentially crazy girlfriend



Re: Your potentially crazy girlfriend

Tyler Perry,

If you don't know by now, I hate Media Take-Out with a passion.

I hate them so much that whenever someone at ONTD posts anything about

Media Take-Out and I try to tell them that Media Take-Out bullshits at

least some of their stories (i.e. "Terrence Howard is gay!" "Eminem is

suicidal!") people look at my posts like I'm crazy (like someone in

the community who suggested I look at Eminem's lyrics at proof that

he's suicidal--despite the fact days after the rumor Eminem was at

Proof's funeral. I refuse to comment).

I didn't believe that you were linked to this crazy woman at first.

Until the Boston Herald put out their report. (I found it at DListed,

BTW.)

And while I was out enjoying some local block parties that the town I

live in won't cancel and the student paper won't write bad editorials

about, solitare found this and posted it at crunk and disorderly.

It must be at least 30% true. You must being seeing this crazy woman

in some way.

Tyler, stop seeing her.

She's just going to make crazy faces to all your relatives and

speakreallyfastwhenshesreallyhappy!

Look, Crazy Woman is what keeps me from relaxing when I watch The

Crazy Former Model Talk Show (but, oddly enough, not America's Next

Top Model because she usually doesn't appear in the whole episode). I

don't care if you're (allegedly) gay or not, step away from the Crazy

Woman. She's about as dangerous as an actual Weapon of Mass

Destruction except she talks and has her own shows and even a music

video which should qualify as a WMD when it was revealed to the

American public.


cin ful sunday my girlfriends kitchen



Cin-ful Sunday - My Girlfriend's Kitchen

Well, if you really need something to do, you could go make some meals

for your family! I have gone to My Girlfriend's Kitchen in Mason

several times and had a lot of fun making my family meals. What's

great about it is that I don't have to make the meals during the week!

It saves us so much time and money! If you don't have time to go

there, don't worry, they are having a special this month!!!! FREE

ASSEMBLY!!! That's right, you heard me, FREE assembly! That means that

you just pick out your meals (you can order online) and then pick your

pick up time and you go get them and they are already made for you!!!

Yay!!! You just need the promo code which is: janfree , just put that

in the box when you are checking out and it will take off your

assembly fee! Oh, one catch, you have to order at least 10 meals. I

ordered mine yesterday!

For $214.00, I got 17 meals that I didn't have to make or shop at the

store for! It may sound expensive to some of you, but I feed a family

of 6 and it is no big thing to spend $200 each week at the grocery

store, so this is actually saving my family money. Here is what we

will be having this month:

All-Star Chicken (2)

Beefcake au Poivre (2)

Cacciatore Chicken (slow-cooked) (1)

Chicken Teriyaki Fortunes, Lo Mein Dreams (2)

Ciao Bella Pot Roast (Slow-Cooked) (1)

Easy Elegant Fish Vera Cruz (2)

Kung Fu Eating (2)

La Burger Calzone Nostra (1)

Sloppy JoAnns (2)

Southwestern BBQ Meatballs (2)


my girlfriend cephalophile



my girlfriend the cephalophile

howdy!

heard from dickson for the first time in a couple years! while we

talked he missed his connecting flight at o'hara airport. we weren't

talking long, so it's not my fault--let's blame it on chaos theory!

what's even worse, he's a travel agent!

but it was good to hear his sunny voice again...

it's true, my girlfriend's turning into a cephalophile. i made up the

word from the cephalopods she's been obsessed with since we returned

from florida. ALL things cephalo (literally, "head foot"): squids,

octopi, arganauts, nautali, etc. she's got all the library's books and

videos on these creatures checked out, and like the proverbial "shrimp

platter", they keep cropping up in our lives. lara, a girl from work

just returned from mexico. "good," she replied to my question about

how the trip went, "i got attacked by an octopus."...like by thy

way...she was walking the beach when she saw an octopus on the shore.

she passed by on the ocean side of it when a wave came up and pulled

it back toward her leg, where he/she/it grabbed on to her leg,

probably thinking, "hey, something to grab on to."

"then it started biting me," she said, also matter-of-factly. she

explained that they were like little ant bites, but i was seeing the

beak from 20,000 LEAGUES UNDER THE SEA. you can't pull an octopus off

if they don't want to be pulled off--another interesting piece of

cephalo trivia. but she was able to get it to attach to her arm

instead, increasing her mobility and allowing her to wave her hand

around in the air like some sort of octopus club.

well, turns out that part of her group expressed disappointment about

leaving without seeing an octopus, when--you guessed it--in walks

lara.

reminds me of the crazy man in jeremiah johnson: "YOU WANTED TO SEE A

GRIZ?

WELL, YOU SKIN THIS ONE, I'LL GO GET ANOTHER..."

well, they were finally able to convincce the octopus to let go by

soaking lara's arm in salt water that was warmed to just the right

temperature, another piece of interesting, and yet practical,

information. (here at "lifestyles of the poor and shameless" magazine,

we aim to INFORM.)

and the new pirates of the caribbean movie (rated ARRRRR!) portrayed

davie jones as as some sort of ceph-human, which was fun to watch, as

was kiera

knightly. but not nearly as much fun as audrey tautou (sp?) who is

truly

outstanding in anything she does--another of my absolutisms.

and yes, distracted again from the meat, the message, the BONES, the

VISCERA! of this which is what, again?

my mom gave me the book "know-it-all" about a guy who reads the

encyclopedia britannica--33,000 pages, 4 feet, two inches tall stacked

together..."a virtual danny de vito of information and facts", he

explains. anyway, he discovers the fine line between being really

informative and being really

annoying. let me know if i ever transgress...

i'm still reminicing about 2006. i know you're thnking it's already

february, but since i haven't mailed my christmas presents yet, i seem

to be right on schedule. i'm refusing to go into politics, but i just

remembered seeing kathy, one of pam's clients. we'd heard so much

about each other that it only seemed right that we meet. a little

background: Kathy had terminal cancer, and that was only one of the

hardships in her life. she lost her husband of 50+ years. she signed

everything over to her son and daughter-in-law and then her son died

on the operating table during routine back surgery, which meant that

her daughter-in-law, whom she doesn't get along with that well, now

owns her house and everything. then her beloved beagle dog dies. her

grandson and wife go to jail for molesting the wife's daughter...all

of this hardship didn't prepare me for what a firecracker she is.

she was so fun, and flirty even, that i would never have guessed that

she was dying. pam was surprised to see her so well, herself. i feel

so lucky to have seen her sparkle, because my next visit, things were

much different.

she was practically bed-ridden drifting in and out of attention,

stopping mid-sentence oftentimes, leaving us the fill in the blanks in

our heads or probe for answers. but there were certain themes she

would come back to--one that i still remember was perry mason, which

makes me re-evaluate my criticisms of television.

she talked wistfully of the things that she can no longer do, or

things that were getting harder to enjoy, like eating. "if you could

have anything in the world to eat right now, what would it be?" i

asked her.

"strawberries," she answered so quickly, like she was expecting the

question.

well, the next time i visited she was completely bedridden, on high

powered pain releivers, and drifting in and out of consciousness. it

was a hard transition to see--and so fast. i think it was only 2 weeks

time. well, i picked out a nice box of strawberries to bring with me

(luckily she didn't say something like "mbane worms"). well, it was

hard to feed her--i had to cut it up and she drifted out a couple of

times before the first one--but when she finally noticed what was

going on she smiled, and you could she was smelling the strawberry's

passage to her lips like a wine conesseur. she ate slowly, savoring it

and smiling.

that was the last time i saw her alive, and that, is one of my

proudest accomplishments of 2006--that strawberry.

this week i turned on the radio and heard the last 2 words of an NPR

interview. they were:

"...toxic schnitzel"


my legendary ex girlfriend ii



My Legendary (ex) Girlfriend - II

Just when I thought I was lacking creative ideas to write about, I met

'V' yesterday...

'V' was like my 'second official girlfriend' of seven days. It was way

back in 2001, when I was a class eleven 'wanna be stud'. 'V' and

family were our tenants for a long four years... but for me and her,

it was over in seven days... even without a date. I still feel guilty

when I think of her for not even spending a single penny on her.

Whatever...

So I was walking through Baikunth Dham colony yesterday when she saw

me. (I also saw her... but I pretended not seeing her. Not because

we're not together anymore, I just dont like meeting anyone when I'm

walking. No talking, just walking).

And then she waved from a kilometer away -

Hiiiiiiiiiiiiiiiiiiiiiiiiiii SS iiiiiiiiiiiiiiiiii SS iiiiiiiiiiii!

I simply said 'Hey' without any exclaimations.

"So What's up"? She asked.

"Just the usual". I replied.

Tu to BE kar raha tha na..

Nahi. Main M. Tech kar raha hu...

Oh!!

And comes the intermission. I hear polyphonic ringtones coming from

within her body. I thought she had mistaken her mobile for something

else the other night. Poor Joke. I also thought it was.

"Excuse me please." she said as she took out her Samsung Slim from

somewhere within her body.

"Yeah sure."

So the chick's got a Samsung Slim... Hmm... Let me take out my brand

new N3230. Oh... where's it. F**K! I forgot it at home. Sh*t! I had no

option left other than standing idle like Abhijeet Sawant and looking

to and fro. "Why do these people act so smart?" I was thinking when

she was telekissing her current boyfriend and saying 'I love you na?'.

I wish Navin Prabhakar was a friend...

"Sorry!" She said as we resumed.

"So what are you doing?" I thought it was high time to start insulting

her.

"Well... I'm doing plain B Com. Waise bhi I want to do MBA. So I

decided to go for B Com. So that I can join Coaching classes. Waise

bhi I didnt score good in twelfth. I'm also doing a job in (a banking

major) for their credit cards. Waise bhi college kaun jaata hai?". She

said all in one breath. Must be accustomed to it. Waise bhi 'Preparing

for MBA' appears to be the most logically sound excuse for taking up B

Com.

"Hmm..." I said and added after giving the 'I am superior' smile

"That's good."

"So are you still working for that software company?"

"Nope. I decided to take a break for this semester. I wanted to focus

on my studies.". This - appeared to me as the most logically sound

excuse for saying "I was not being paid." I noticed that she had

clinched the 'I am superior' smile from me.

"Chal yaar abhi mereko jaana hai. baad me milte hai."

"Huh. Bye."

I stood there for a while and saw her disappearing. She lives on the

same street but somehow I got lost in my thoughts and didnt notice her

actually going away. All this time I was thinking about just three

things:

1. 14th August 2001.

2. An old fashioned bedroom.

3. A passionate kiss.


my boyfriends girlfriend



My boyfriend's girlfriend

In case you didn't know, my boyfriend, Nathan considers his other

girlfriend to be Natalie Portman...although now he says he's ditching

her cuz apparently she's a zionist. Regardless, if you haven't seen

her recent skit on SNL I suggest you check it out. It's rules. My

favourite part is when she breaks the beer bottle over her head. Just


friscos got girlfriend



Frisco's got a girlfriend...

Frisco has a girlfriend. Her name is Chainsaw, she weighs less than 10

lbs and is of the feline persuasion.

Right now they are laying side by side on the living room floor trying

to stay cool and take an afternoon snooze.

Apparently, Chainsaw thinks she's a dog. so, it makes sense that since

Frisco thinks he's a cat, they make a perfect pair. I wasn't sure if

frisco would take to having kitties around, but he's really done

great. Chainsaw has helped, of course. She's kept him in his place and

shows him who's boss. She's swiped at him a few times, but never bared

her claws which i take as a good sign because according to her

mom...she can be one mean kittie.

The two of them started slow, keeping their distances. But then i

noticed that every time we went outside Frisco started sniffing around

the places that Chainsaw hangs out. (she's mostly an outside cat) I

thought perhaps he was just curious, but he'd spend several minutes

poking his nose into various crevasses around the back porch. he kept

doing this with ever-increasing energy and feverishness, it was weird.

Then, Chainsaw started hanging out up on our deck. Good sign. So,

Frisco would immediatley find her and start sniffing, then backing

away, sniffing, then backing away. A lovely dance those two have.

It got so that Frisco would mostly keep still when she came around,

then they'd pretty much ignore each other...until Chainsaw decided to

take the next step. She started getting really close and trying to rub

on Frisco's legs. He wasn't too sure about this at first, jumping up

and running away the first few times. I think he thought it was a

setup of some kind, you know?

Anyhow, with increasing tolerance Frisco got used to her advances and

they found a happy medium.

Then, the other night it was storming.

Chainsaw was hanging out on our deck and I was herding frisco in from

a brief potty break. She was right next to the door and when I opened

it she quickly invited herself in.

Frisco wasn't sure what to do. There was a cat in his house.

It was so funny. He got really excited. He started pacing around and

drooling and panting, his nub wagging the whole time. Chainsaw slowly

made her way around the apartment (all 2 rooms- hehe) and followed her

everywhere. Sniffing at her here and there. The entire time, she

seemed completely unfazed while Frisco was about to have a heart

attack. I was caught between being really worried and laughing

hysterically at the spectacle.

After about a 1/2 hour, Frisco still hadn't calmed down..hadn't even

sat down really...so I decided that Chainsaw had to go back outside

(the weather had calmed a little, don't worry)

That was 2 days ago.

Today, she came for a visit again and this time Frisco has been able

to calm himself down and, while aware and interested, doesn't seem too

concerned about her prescence. I can't wait to get a picture of these

two up for you to see. It's so sweet. Frisco still gets flustered and

backs away a bit when Chainsaw rubs up against him, but I think he'll

get used to it.

I'm just happy to see him doing so well with a cat.

I think part of it is that Chainsaw doesn't back down or run away. In

the beginning they had several staring contests and she won all of

them. Now, the other kittie (Pretty Kitty) who lives here runs away at

the mere sight of Frisco and I think it encourages him. When they run,

he thinks its a game. "Wow. look at her go...wait for me!" -- i can

hear him think to himself.

But Chainsaw just sits there...boring...so he finds other things to

do....like go back to sleep.

Speaking of how compfy Frisco is getting, he's slept on the couch 2

nights in a row now. Which is where he usually likes to sleep...before

that he'd follow me around until i went to bed and only then would he

lay on his pillow in my room and, cautiously, go to sleep.

Think these posts are long enough?


psychic girlfriend miss cleo




ka gerry my girlfriend is so funny



Ka Gerry: "My Girlfriend is so Funny!"

"My girlfriend is so funny!"

Two words: There's no such thing. A girl that is funny is either an

old friend or a stupid seatmate who hates the boss and always rants

about how much work she's doing while the boss just sits around all

day surfing the net. Your oldest friend is funny only because you've

been friends with her for such a long time that you almost always know

what each other is thinking - thus, she is only funny because she

thinks like you. Same with your seatmate, you both hate your boss so

it's funny to hear your thoughts through the lips of someone else who

might get in trouble for it.

Girls, let me tell you a little secret. If a man laughs around you, it

could only mean two things: either he wants to sleep with you or you

did something stupid. If you are hot, you can be certain it's the

former. You're not funny. Your jokes are corny and the delivery is

just horrible but a man will still listen to you simply because you're

hot. On the other hand, if you're not a very attractive woman, a man

will only laugh at you because you did something stupid that too him

is funny. Let me clarify that, you are not funny, it's the humiliating

yourself part that is funny.

Of course, there will be times, rare times, when your girlfriend can

make you laugh with a brilliant joke or a limerick of some kind but

that doesn't make her a funny person. Most of the time, you just smile

to applaud the time and effort your girlfriend put in for trying to be

funny. It's cute, yes, but then again not really funny.

Think of it this way, being funny is different from having a sense of

humor - having a sense of humor means being able to appreciate funny

while being funny means being able to make fun of anything -

preferably people - around you. Funny thing is that men are better at

making fun of other people (some girls are good at that too but that's

just wrong and mean - that's why it's funny to us, men, too); girls,

most of them at least, in contrast, are too kind to do that so they

make fun of themselves instead, which is exactly the reason why you

don't want a funny girlfriend. People will laugh at her and of course,

at her stupid boyfriend as well.

The question really is, why would you need a funny girlfriend for? You

get a lot of funny from your friends, colleagues, from TV and Radio,

and from everywhere else. What you need is someone you to enjoy these

jokes and funny moments with. You can make fun of other people, you

can laugh all you want about anything, just make sure that it is at

the expense of other people and you will live happily ever after.


dont cha wish ya girlfriend was hot



"Don't Cha Wish Ya Girlfriend Was Hot Like Me"

Ms. Lindsey Ms. Lindsey, this one's for you! Here is yet another

fantastic example of who all girls should be like. Ms. Lindsey has

been one of my good friends since way back in Kindergarten. 14 years,

wowsers. Anyways, Ms. Lindsey is one of the best I know. She's smart,

funny, pretty, optomistic, has the same thought pattern and same ideas

that I have. We talk about everything under the sun, and sometimes

even more than that. It's great to know that there are girls out there

like Ms. Lindsey and she gives me hope for the female species :)

"She's not an ordinary girl

I can see it in her eyes

I'm just an ordinary boy

God must have heard my prayers last night

She's been on my mind (she's working overtime)

She's got perfect reasons

Says she loves to talk to Jesus

I think I believe her when she says


2006_03_01_archive



Beaut-E-News


2007_03_01_archive



Dollar and a Half Cardigan

So I have decided to join a knit a long for the Dollar and a Half

Cardigan in the Spring Interweave magazine. It is the first time I

have actually joined a knit a long so we will see how that goes. I

will have to remember to post my progress. Right now though I am still

in the stages of choosing my yarn for this cardigan.

Posted by Shannon at 11:23 AM 0 comments

Thursday, March 1, 2007

A finished scarf and some new roving

I finished a scarf for myself!!! It's the first thing I have started

and finished absolutelly for myself. My boyfriend says I need to hide

it so nobody globs onto it. Which is what usually happens to the stuff

I knit. Anyway I made it out of the Malabrigo yarn I got from my

knittyboard sp and I absolutely love this yarn. It was a dream to work

with and it knit up quickly. Here is a picture of the finished scarf

close up. I had a picture of me wearing it but seriously didn't want

to subject anyone to that.

And now I am spinning some yarn. I am trying to make a camo yarn and

it is turning out pretty well. It's more feminine than the normal

camo, which was on purpose because I plan on knitting something for my

sister with it. Which she HAS to have something pink on everything she